PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn141671
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family G2-like
Protein Properties Length: 300aa    MW: 33938.4 Da    PI: 6.1092
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn141671genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like86.33.1e-27113165255
     G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                 + ++WtpeLH++Fv+ave+L G ++A+P++ilelmkv+gLt+++v+SHLQkYR+
  Achn141671 113 QGVDWTPELHKKFVRAVENL-GVDQAIPSRILELMKVEGLTRHNVASHLQKYRM 165
                 6689****************.********************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.816108168IPR017930Myb domain
SuperFamilySSF466893.14E-18111168IPR009057Homeodomain-like
TIGRFAMsTIGR015571.6E-24112166IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.606.6E-26112168IPR009057Homeodomain-like
PfamPF002493.5E-8116164IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 300 aa     Download sequence    Send to blast
MRNCVHMWWI PIGSKMSAFC NEDEALSAIS DKPESFHIAI VEAFNAEGNE LSESLKPVKE  60
SMVSLLHFQL ENGEQKSSIS EETEHETAVE ENGQGQSEES DEYQAPPTPQ LKQGVDWTPE  120
LHKKFVRAVE NLGVDQAIPS RILELMKVEG LTRHNVASHL QKYRMQRRHI LPKEDVKRAP  180
HPRDLSQRNY YPHKHVMAFP PYPSNPILPS GQVYPAWGHP PGSYLTGAQT WGHAFYPPWQ  240
PMESWHWKPY SGEEEVIDKV VNEAISKPWL PLPLGLKPPS IDSVLTELSK QGISTIPPH*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A4e-16108170163ARR10-B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016436053.11e-80PREDICTED: two-component response regulator-like APRR2
RefseqXP_016436052.11e-80PREDICTED: two-component response regulator-like APRR2
RefseqXP_016436051.11e-80PREDICTED: two-component response regulator-like APRR2
RefseqXP_016436050.11e-80PREDICTED: two-component response regulator-like APRR2
SwissprotQ6LA434e-40APRR2_ARATH; Two-component response regulator-like APRR2
TrEMBLB9SNR62e-81B9SNR6_RICCO; Transcription factor, putative
STRINGVIT_02s0012g00570.t014e-78(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA56731531
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18020.66e-42ARR-B family protein